PDA

View Full Version : Word game


rf_ucsd
08-10-2003, 10:05 PM
What is the longest word you can think of that, in its spelling, does not require any letter to be used more than once?

The longest we could think of was 11 letters in length.

Leaver
08-10-2003, 10:07 PM
anticonstitutionnellement :D

fifi
08-10-2003, 10:07 PM
:huh: :stunned: mmmmmmmm..... :/

Leaver
08-10-2003, 10:08 PM
the longest word in french :D

jewl*
08-10-2003, 11:58 PM
:huh:

WEE!

jewl*
08-10-2003, 11:59 PM
damnit~

rf_ucsd
09-10-2003, 12:28 AM
damnit


Not bad. Six letters.

jewl*
09-10-2003, 12:50 AM
:lol: :lol:

fifi
09-10-2003, 07:17 PM
Onomatopoeias?? :lol: :lol:

Professor Peedston
09-10-2003, 09:14 PM
i think some people misunderstood... you can't repeat any letters.

uh....

franchise

if we want to do longest word you can think of, i've got antidisestablishmentarianism :rolleyes:

so what's the 11 letter word, anyway?

rf_ucsd
09-10-2003, 09:25 PM
centrifugal

blangy
09-10-2003, 09:57 PM
:o

Sally_
10-10-2003, 01:51 AM
what does that mean?

el_scorcho
10-10-2003, 05:31 AM
antidisestablishmentarianism :D

Rain
10-10-2003, 05:47 AM
antidisestablishmentarianism

Doesn't that mean lack of memory or intelligence or something along those lines?

el_scorcho
10-10-2003, 05:49 AM
I have no sweet clue what it means, I just know that my bf told me it was the longest word ever. :P

Professor Peedston
10-10-2003, 06:14 AM
and that i wrote it four posts before you did. :P

rf_ucsd
10-10-2003, 07:14 AM
I kind of get the feeling that Tom is the only person that understands.

girlstar
10-10-2003, 07:17 AM
Nah I do.

weedy_gonzalez
10-10-2003, 09:13 AM
konstantynopolitańczykiewiczówianeczka <---supposed to be a lastname (that`s polish of course)

girlstar
10-10-2003, 12:09 PM
But you used letters twice.
Holy moly that's a huge last name! :o
Umm umm Kasia where are you from again? We were talking about a place in Poland today...oh what was is called? Katawice or something? Damn it I can't remember! But yeah it reminded me of you! :dozey: :D

DoogieJ
10-10-2003, 12:44 PM
hmmm Birthdays is nine

*thinks*

btw floccinoccinilhilpilification is longer than antidisestablishmentarianism by one letter :)

ill go think of sinle letter long words

el_scorcho
10-10-2003, 12:54 PM
and that i wrote it four posts before you did. :P

:embarrased: Oopsies

DoogieJ
10-10-2003, 01:02 PM
uncopyrightable - 15 letters :)

rf_ucsd
10-10-2003, 04:56 PM
uncopyrightable - 15 letters


AWESOME!

Awesome, awesome, awesome.

Damn. You MADE my day!

YES!

DoogieJ
10-10-2003, 05:31 PM
heheh, i thought of copyright (thanks to inspiration around work) then just kept adding...I hope it's a legal word, didn't have a dictionary at work :)

Professor Peedston
10-10-2003, 09:10 PM
yeah that's a good one

Professor Peedston
10-10-2003, 09:11 PM
but unfortunately, not an actual word. or so says my fatass webster's dictionary.

rf_ucsd
10-10-2003, 10:11 PM
i think it's a word.

dictionaries aren't going to list all versions of a word once amended by suffixes and prefixes. does that mean uncopyrightable is a word? not necessarily, but it also doesn't eliminate the possibility that it is.

Professor Peedston
11-10-2003, 03:21 AM
well, my dictionary lists copyrightable, copyrighted, etc., but not uncopyrightable. also if you go to dictionary.com, and type into the search thing, it recognizes all the variations with suffixes and prefixes as words except for uncopyrightable. that doesn't necessarily eliminate the possibility that it is either, but it's a case against it.

either way, i don't think anybody's going to rat you out and say "wait a minute, that's not a word!" if you use "uncopyrightable" in a sentence. :P

soleil
11-10-2003, 03:32 AM
when i saw it, it didn't seem like a word, but i guess since we're trying to reach some kind of record here, it will do.

:D

i'm really bad with words, so i'm probably not going to think of anything really good. got 0 vocab. :dozey:

rf_ucsd
11-10-2003, 09:58 PM
well, my dictionary lists copyrightable, copyrighted, etc., but not uncopyrightable. also if you go to dictionary.com, and type into the search thing, it recognizes all the variations with suffixes and prefixes as words except for uncopyrightable. that doesn't necessarily eliminate the possibility that it is either, but it's a case against it.

either way, i don't think anybody's going to rat you out and say "wait a minute, that's not a word!" if you use "uncopyrightable" in a sentence. :P

Good points all around.

jewl*
12-10-2003, 02:44 AM
:sneaky:

uncontrolable. 13 letters!!

rf_ucsd
12-10-2003, 02:54 AM
uncontrollable?

3 l's, 2 n's, 2 o's ... way 2 many repeats.

jewl*
12-10-2003, 03:29 AM
OOOOHH!! Forgot about that...


WOOPS

Professor Peedston
12-10-2003, 11:23 AM
LOL yeah that wasn't even close to counting. :P

LiquidSky
13-10-2003, 10:48 PM
The longest word I think of right now is Kaleidoscopico ;)

jewl*
16-10-2003, 01:13 AM
But doesnt that have more than one letter used twice?

jewl*
16-10-2003, 01:15 AM
when i saw it, it didn't seem like a word, but i guess since we're trying to reach some kind of record here, it will do.

:D

i'm really bad with words, so i'm probably not going to think of anything really good. got 0 vocab. :dozey:

Oh my Gosh your avator it beautiful....

LiquidSky
16-10-2003, 01:35 AM
But doesnt that have more than one letter used twice?


well that's how you say it and write it in spanish... :cool: :P

jewl*
17-10-2003, 10:08 PM
:lol:

jewl*
17-10-2003, 10:09 PM
Hystoricle

There ya go!! 10 letters!! :lol: :blush:

LiquidSky
17-10-2003, 10:10 PM
ooooooohhhhhhhhhkkkkkkkkkkkkkkkkkk

jewl*
21-10-2003, 11:29 PM
Erm.. what do we do now??

noni
22-10-2003, 12:32 AM
The longest word I know in spanish is 'noramidopirinometasulfonato'
but there are repeat letters... oops :/

';'
22-10-2003, 03:02 AM
uncopyrightable - 15 letters :)damnit i went to look it up and found that word....then came back and saw someone already found it. :(

rf_ucsd
22-10-2003, 03:11 AM
15 letters blows away anything i thought we could come up with when we started this thread. i think it just goes to show that DoogieJ is pretty damn brilliant.

';'
22-10-2003, 03:18 AM
maybe he looked it up too.

rf_ucsd
22-10-2003, 03:20 AM
true.

but if he did, he's brilliant for looking it up.

Naughtyfig
22-10-2003, 03:23 AM
school

LiquidSky
22-10-2003, 08:28 PM
^
Hi Lois! :)

LiquidSky
22-10-2003, 08:40 PM
this is the longest word in the english language...



Methionylglutaminylarginyltyrosylglutamylserylleuc
ylphen-
ylalanylalanylglutaminylleucyllysylglutamylarginyl
lysylgluta-
mylglysylalanylphenylalanylvalylprolylphenylalanyl
yalylthre-
onylleucylglcycylaspartylprolylglicylisoleucygluta
mylgluta-
minlserylleucyllysylisoleucylaspartylthreonylleucy
lisoleu-
cylglutamylalanylglyclyalanylaspartylalanylleucygl
utamylle-
ucylgluycylisoleucylproluylphenylalanyserylasparty
prolylleu-
celalanylaspartylglycylprolylthreonylisolleucyglut
aminylaspa-
raginylalanythreonylleucylarginylalanylphenylalany
lalanylal-
anylglycylvalylthreonylprolylalanylglutaminylcyste
inylphen-
ylalanylglglutamylmethionylleucyalanylleucylisoleu
cylarginyl-
glutaminyllysylhistidylprolyuthreonylisoleucylprol
ylisoleuc-
ylglycylleucylleucylmethionyltyrosylalanylasbaragi
nylleucyl-
valylphenylalanylsparaginyyllysylglycylisoleucylas
partylglut-
amylphenylalanylyltyrosylalanylglutaminylcysteinyl
glutamyll-
ysylvalylglycylvalylspartylserylvalylleucylvallala
nylaspart-
ylvalylprolylvalvlglutaminylglutamylserylalanylpro
lylpheny-
lalalrginylglutaminylalanylalanylleucylarginylhist
idylasp-
araginylvalylalalprolylisoleucylphenylalanylisoleu
cylcystei-
nylprolyprolylaspartylalanylaspartylaspartyspartyl
eucylle-
ucylarginylglutaminylisoleucylalanylseryltyroslgly
cylargin-
ylglycyltyrosylthreonyltyrosylleucylleucylserylarg
inlalanyl-
glycylvalylthreonylglycylalanylglutamylasparaginyl
arginyla-
nylalanylleucylprolylleucylaspaaginylhistidylleucy
lvalylalan-
yllysylleucyllysylglutamyltyrosylasparagimylalanyl
alanypro-
lylprolylleucylglutaminylglycylphenlalanylglycylis
oleyucyls-
erylalanylprolylaspartylglutaminylvalyllysylalanyl
alanylisol-
eucylalspartylalanylglycylalanylalanylglycylalanyl
asoleucylse-
rylglycylserylalanylisoleucylbalyllysylisoleucylis
oleucylgluta-
mylglutaminylhistidylasparaginylisoleucylglutamylp
ronylglu-0
tamyllysylmethionylluecylalanylalanyoeucyllysylval
ylpheny-
lalanylvalylglutamilylprolylmethionyllysylalanylal
anylthreo-
nylarginylserine.


This word is a Tryptophan synthetase A protein, an enzyme that has 267 amino acids, and makes a record of 1,909 letters. It is the term for the formula C1289H2051N343O375S8.

LiquidSky
22-10-2003, 08:41 PM
antidisestablishmentarianism

LiquidSky
22-10-2003, 08:44 PM
hippopotomonstrosesquipidelian ;)

LiquidSky
22-10-2003, 08:45 PM
pneumonoultramicroscopicsilicovolcanoconiosis :lol:

LiquidSky
22-10-2003, 08:50 PM
The longest word in the world:

kyyhkyslakkahillotaatelipalmusunnuntaikävelykatuju hla-
koristehedelmäkaramellimassatuotevalvontalaitteist o-
testauslaboratoriokäyttökertatulitikkuviinapiiloho mo-
kaasulasersädehoitokotikaljakimblemestaruussarjaku va-
ristikkokilpajuoksuhiekka-aavikkoluonto-ohjelmauusinta-
vaalikokousedustusmeno-paluuruuhkabussivuoropysäköinti-
sakkolihakoukkuselkänahkavyöruusukasvimaamunajuust omaito-
rasvaimunestepinta-alahuulipunakampelaverkkomahalasku-
harjoitustyöaamukampapellavaöljykriisiapukeinolonk kalepo-
lomarusketusrajatietoteollisuuskiinteistömarkkinoi nti-
diplomi-insinööriopiskelijaperinnemaisema-arkkitehti-
kilta-aktiivihiiliteräsbetonivalurautaristisiitoshärkä-
pizzamaustevoipaperiroskapostimerkkisavusaunavasta protesti-
marssivapautusliikevaihtoväliarvojoukkopakomatkaop as-
koirakantakorttitaikatalvisotakunniajäsenetupuolik uiva-
rehuvilja-aittakorpisuomaastohiihtoputkitiivistesilikoni-
rintataskuvaraslähtöliukumiinakenttäkeitinvesihana saari-
ryhmätyömyyrävuosikurssikirjapainopistetulotukivar sikenkä-
kauppaopistoupseerikerhohuonepalveluammattikoulupo ika-
tyttöenergiatalousaluelaajennustarvehierarkiakaavi o-
suunnittelupäätöspäivävientisulkuporttiteoriapohja kunto-
urheiluruutuässäpariluistelutyylituomaripelimies-
voimisteluvideokulmakarvakuonokoppalakkipäämääräal ennus-
tilataksimittarimatopurkkikeittoastiakaappipakasti n-
yhdistelmälukkoseppähenkilötunnussanaleikkikalupak kipussi-
eläinkoeponnistuslautakuntalakitekstiseikkailuleir i-
telttakangaspuujalkasienipiirakkareseptivihkopakka us-
muovikuularuiskumaalaustarvikevarastohyllymetrilak uavain-
naulakkovartiopäällikkötasogeometriavirhevaihtosäh kökazoo-
pillihousupukupellehyppylankakeräkaaliaivovuotosuo ja-
vaatekappalemyyntitykkilavatanssiaskelmoottoripyör ä-
koppisiemenperunapalstajakoviivaintegraalioperaatt ori-
algebraoppilaitoskompleksilukusuoraveto-oikeusmurha-
asevarikkopilttuu

If you read the grammatical explanation above, you should realize that Finnish allows for words of arbitrary length.

it doesn't mean anything

LiquidSky
22-10-2003, 08:52 PM
If you want to study the word deeper, here is a detailed breakdown. On the left the actual words and their translations are listed one by one. On the right is the compound word formed by the word on the left and the one above that.
Some words are jargon, special terms, "professional language" or otherwise difficult to translate. So you shouldn't trust the translations blindly. The letters XXX mean that we didn't come up with a proper translation.
kyyhkys, actually "kyyhkynen", a dove
lakka, an arctic cloudberry kyyhkyslakka, a dovecot
hillo, jam lakkahillo, cloudberry jam
taateli, a date (the fruit) hillotaateli, a date used to make jam
palmu, a palm taatelipalmu, a date tree
sunnuntai, Sunday palmusunnuntai, Palm Sunday
kävely, walking sunnuntaikävely, a promenade
katu, a street kävelykatu, a pedestrian street
juhla, a party katujuhla, a street party
koriste, a decoration juhlakoriste, a party decoration
hedelmä, a fruit koristehedelmä, a decorative fruit
karamelli, a candy hedelmäkaramelli, a fruit flavoured candy
massa, mass karamellimassa, caramel mass
tuote, a product massatuote, a mass product
valvonta, monitoring, controlling tuotevalvonta, product quality control
laitteisto, equipment valvontalaitteisto, monitoring equipment
testaus, testing laitteistotestaus, equipment testing
laboratorio, a laboratory testauslaboratorio, a testing laboratory
käyttö, usage laboratoriokäyttö, laboratory use (as in "only for laboratory use")
kerta, a time (as in "the third time") käyttökerta,an instance of usage
tuli, fire kertatuli, shooting a gun only one bullet at a time (not in the fully automatic mode)
tikku, a splinter, a small piece of wood tulitikku, a match
viina, alcohol tikkuviina, XXX industrial alcohol
piilo, a hideout viinapiilo, a place to hide alcohol
homo, a homosexual piilohomo, a person not known to be a homosexual
kaasu, gas homokaasu, gay gas, see here
laser, a laser kaasulaser, a gas laser
säde, a ray lasersäde, a laser beam
hoito, treatment sädehoito, radiation treatment
koti, a home hoitokoti, a nursing home
kalja, beer kotikalja, home-made beer
Kimble, a board game kaljakimble, beer Kimble, a drinking game
mestaruus, a championship kimblemestaruus, Kimble Championship
sarja, a series mestaruussarja, a championship series
kuva, an image, a picture sarjakuva, a comic
ristikko, a grating kuvaristikko, a crossword puzzle that has some pictures as hints
kilpa, a competition ristikkokilpa, a crossword puzzle competition
juoksu, a run kilpajuoksu, a race (in the sense of "arms race")
hiekka, sand juoksuhiekka, quicksand
aavikko, a desert hiekka-aavikko, a desert (emphasizing the sand)
luonto, nature aavikkoluonto, the nature in a desert
ohjelma, a program luonto-ohjelma, a nature document
uusinta, a repeat or re-run ohjelmauusinta, a re-run of a tv-show
vaali, an election uusintavaali, a repeat election
kokous, a meeting vaalikokous, an election meeting
edustus, a representative kokousedustus, a delegate in a meeting
meno, an expense or the act of going somewhere edustusmeno, representational expense
paluu, coming back meno-paluu (lippu), a two-way ticket
ruuhka, traffic jam paluuruuhka, a traffic jam due to people returning from holiday
bussi, a bus ruuhkabussi, a rush hour bus
vuoro, a turn or a schedule bussivuoro, a bus departure
pysäköinti, parking vuoropysäköinti, alternating parking
sakko, a fine pysäköintisakko, a parking fine
liha, meat sakkoliha, a person too young to have sex with a grown up (yes, the literal translation is "fine meat")
koukku, hook lihakoukku, a meat hook
selkä, back koukkuselkä, an old person with a crooked back
nahka, skin selkänahka, the skin on your back
vyö, a belt nahkavyö, a leather belt
ruusu, a rose vyöruusu, shingles
kasvi, a plant ruusukasvi, a plant of the genus 'Rosa'
maa, ground, earth kasvimaa, a small garden for carrots, radishes, and so on
muna, an egg maamuna, an earthball or puffball
juusto, cheese munajuusto, egg cheese
maito, milk juustomaito, beestings
rasva, fat maitorasva, lactic fat
imu, suction rasvaimu, liposuction
neste, liquid imuneste, lymph
pinta, surface nestepinta, a liquid surface
ala, an area pinta-ala, an area
huuli, a lip alahuuli, lower lip
puna, redness huulipuna, lipstick
kampela, a flounder punakampela, a plaice
verkko, a net kampelaverkko, a fishing net for flounder
maha, stomach verkkomaha, reticulum (a division of a ruminant's stomach)
lasku, a bill, a landing, a calculation mahalasku, a failed aeroplane landing, also a general term describing a failed attempt
harjoitus, an exercise laskuharjoitus, a mathematical exercise
työ, work harjoitustyö, an exercise project
aamu, a morning työaamu, a morning when you have to go to work
kampa, a comb aamukampa, a device used by people in the army to count how many days of service they have left
pellava, linen kampapellava, worsted linen
öljy, oil pellavaöljy, lindseed oil
kriisi, a crisis öljykriisi, the oil crisis
apu, help, aid kriisiapu, emergency aid
keino, a mean (to an end) apukeino, an aid
lonkka, hip keinolonkka, an artificial hip
lepo, rest lonkkalepo, a military term, standing at ease loosely
loma, a vacation lepoloma, a particularly relaxing vacation
rusketus, a tan lomarusketus, a tan acquired on a holiday
raja, a border rusketusraja, a tanning line
tieto, knowledge rajatieto, knowledge on UFOs and paranormal phenomena
teollisuus, industry tietoteollisuus, the IT industry
kiinteistö, real estate teollisuuskiinteistö, industrial real estate
markkinointi, marketing kiinteistömarkkinointi, real estate marketing
diplomi, a diploma markkinointidiplomi, a marketing diploma
insinööri, an engineer diplomi-insinööri, Master of Science (Engineering)
opiskelija, a student insinööriopiskelija, an engineering student
perinne, a tradition opiskelijaperinne, a student tradition
maisema, scenery perinnemaisema, a traditional scenery
arkkitehti, an architect maisema-arkkitehti, a landscape architect
kilta, a guild arkkitehtikilta, the guild of architects
aktiivi, an active person kilta-aktiivi, an active person in the guild
hiili, carbon aktiivihiili, activated carbon
teräs, steel hiiliteräs, carbon steel
betoni, concrete teräsbetoni, ferroconcrete
valu, cast(ing) betonivalu, concrete cast
rauta, iron valurauta, cast iron
risti, a cross rautaristi, the Iron Cross
siitos, breeding ristisiitos, cross-breed
härkä, a bull siitoshärkä, a stud-bull
pizza, a pizza härkäpizza, a pizza with beef
mauste, a spice pizzamauste, pizza spice
voi, butter maustevoi, flavored butter
paperi, paper voipaperi, butter-proof paper
roska, a trash paperiroska, paper garbage
posti, mail roskaposti, junk mail
merkki, a sign postimerkki, a stamp
savu, smoke merkkisavu, signalling smoke
sauna, a sauna savusauna, a chimneyless sauna
vasta, against (prefix), a birch whisk saunavasta, a birch whisk used in sauna
protesti, a protest vastaprotesti, a counter-protest
marssi, a march protestimarssi, a protest march
vapautus, liberation marssivapautus, XXX
liike, movement, a shop vapautusliike, a freedom movement
vaihto, exchange liikevaihto, turnover
väli, an interval vaihtoväli, a switch interval
arvo, value, worth väliarvo, intermediate value
joukko, a group arvojoukko, the range of a function (math)
pako, an escape joukkopako, a mass escape
matka, a journey, a trip pakomatka, flight (an escape)
opas, a guide matkaopas, a travel guide
koira, a dog opaskoira, a guide dog
kanta, a basis, a stub koirakanta, dog population
kortti, a card kantakortti, a card used in the mass transit system
taika, magic korttitaika, card magic
talvi, winter Taikatalvi, The Magical Winter (a book by Tove Jansson)
sota, war Talvisota, the Winter War (1939-1940)
kunnia, honor sotakunnia, war honor
jäsen, a member kunniajäsen, an honorary member
etu, front (prefix), an advantage jäsenetu, a membership bonus
puoli, half etupuoli, the front side
kuiva, dry puolikuiva, semi dry
rehu, fodder kuivarehu, dried fodder
vilja, cereal (as in wheat) rehuvilja, cereal fodder
aitta, a rural storage building of sorts vilja-aitta, a granary
korpi, a remote rural area Aittakorpi, a place in Kotka
suo, a swamp korpisuo, a type of wetlands, boggy (swampy) forest
maasto, terrain suomaasto, a swampy area
hiihto, skiing maastohiihto, cross-country skiing
putki, a pipe hiihtoputki, an underground ski tunnel
tiiviste, a seal, a gasket putkitiiviste, a pipe gasket
silikoni, silicone tiivistesilikoni, sealing silicone
rinta, a breast silikonirinta, a silicone breast
tasku, a pocket rintatasku, a breast pocket
varas, a thief taskuvaras, a pickpocket
lähtö, start varaslähtö, an early start (jumping the gun)
liuku, a slide, a glide lähtöliuku, the starting glide (for example in swimming)
miina, a mine (the kind that explodes) liukumiina, a cow patty
kenttä, a field miinakenttä, a mine field
keitin, a cooker kenttäkeitin, a field cooker
vesi, water keitinvesi, cooking water
hana, a faucet vesihana, a faucet
saari, an island Hanasaari, an island near Helsinki
ryhmä, group saariryhmä, an archipelago
työ, work ryhmätyö, team work
myyrä, a mole työmyyrä, a very hard-working person
vuosi, a year myyrävuosi, a mole year
kurssi, a course vuosikurssi, a class (as in "the class of 95")
kirja, a book kurssikirja, a course book
paino, a weight kirjapaino, a printing house
piste, a dot painopiste, the center of mass
tulo, a product pistetulo, dot product
tuki, support tulotuki, income support
varsi, a stem tukivarsi, a supporting structure
kenkä, a shoe varsikenkä, a boot
kauppa, a shop kenkäkauppa, a shoe store
opisto, a kind of school kauppaopisto, business school
upseeri, an officer opistoupseeri, an NCO (non-commissioned officer)
kerho, a club upseerikerho, the officer's mess
huone, a room kerhohuone, a club room
palvelu, service huonepalvelu, room service
ammatti, a profession palveluammatti, a service profession
koulu, a school ammattikoulu, vocational school
poika, a boy koulupoika, a school boy
tyttö, a girl poikatyttö, a tomboy
energia, energy tyttöenergia, girl power
talous, an economy energiatalous, energy economy
alue, an area talousalue, an economic zone
laajennus, expansion aluelaajennus, an expansion of area
tarve, a need laajennustarve, the need for expansion
hierarkia, a hierarchy tarvehierarkia, a hierarchy of needs
kaavio, a diagram hierarkiakaavio, a hierarchy diagram
suunnittelu, planning, designing kaaviosuunnittelu, diagram planning
päätös, a decision suunnittelupäätös, a design decision
päivä, a day päätöspäivä, the final day (for example, of school)
vienti, export päivävienti, daily export
sulku, a blockade vientisulku, export blockade
portti, a gate sulkuportti, a sluice gate
teoria, a theory porttiteoria, the gate theory (which states that using mild drugs leads to stronger drugs)
pohja, a basis, bottom teoriapohja, theory basis
kunto, condition (physically) pohjakunto, [someone is in] really bad shape
urheilu, sports kuntourheilu, fitness sports
ruutu, a square Urheiluruutu, a Finnish sports programme
ässä, an ace ruutuässä, the ace of diamonds
pari, a pair ässäpari, a pair of aces
luistelu, skating pariluistelu, pair skating
tyyli, style luistelutyyli, skating style
tuomari, a judge tyylituomari, a judge that gives style points (such as in skating and dancing)
peli, a game tuomaripeli, XXX
mies, a man pelimies, a gambler, XXX
voimistelu, gymnastics, exercising miesvoimistelu, male gymnastics
video, a video voimisteluvideo, an exercise video
kulma, a corner Videokulma, "video corner", a video rental store in Jämsä
karva, a hair kulmakarva, an eyebrow
kuono, a snout karvakuono, a pet name for a dog
koppa, a basket (sort of) kuonokoppa, a muzzle
lakki, a cap koppalakki, a nickname for police
pää, a head lakkipää, a person wearing a cap
määrä, an amount päämäärä, a target
alennus, a discount määräalennus, bulk discount
tila, a state alennustila, a sorry state
taksi, a taxi tilataksi, a large taxi
mittari, a meter taksimittari, taxi meter
mato, a worm mittarimato, a caterpillar
purkki, a can matopurkki, a can of worms
keitto, soup purkkikeitto, canned soup
astia, a dish (such as a plate) keittoastia, a cooking dish
kaappi, a cupboard astiakaappi, a cupboard for dishes
pakastin, a freezer kaappipakastin, a large freezer
yhdistelmä, a combination pakastinyhdistelmä, a fridge-freezer combination
lukko, a lock yhdistelmälukko, a combination lock
seppä, a blacksmith lukkoseppä, a locksmith
henkilö, a person seppähenkilö, a blacksmith (emphasizing that he is a person)
tunnus, an emblem henkilötunnus, the social security number
sana, a word tunnussana, a password
leikki, a game, a play sanaleikki, a pun
kalu, a tool leikkikalu, a toy
pakki, a container of sorts, usually made of metal kalupakki, a toolbox
pussi, a bag pakkipussi, a military term, not easily explainable
eläin, an animal pussieläin, a marsupial
koe, a test eläinkoe, an animal test
ponnistus, a jump koeponnistus, a test jump
lauta, a board ponnistuslauta, a springboard
kunta, a municipal lautakunta, a board (a body of administrators)
laki, the law kuntalaki, county law
teksti, text lakiteksti, law text
seikkailu, an adventure tekstiseikkailu, a text adventure
leiri, a camp seikkailuleiri, an adventure camp
teltta, a tent leiriteltta, a camping tent
kangas, cloth telttakangas, tent cloth
puu, wood, tree kangaspuu, a loom
jalka, a foot, a leg puujalka, a wooden leg
sieni, a mushroom jalkasieni, athlete's foot
piirakka, a pie, a quiche sienipiirakka, a mushroom quiche
resepti, a receipt, a recipe piirakkaresepti, a pie recipe
vihko, a notebook reseptivihko, a recipe notebook
pakkaus, a package vihkopakkaus, a package of notebooks
muovi, plastic pakkausmuovi, packing plastic
kuula, a ball muovikuula, a plastic ball
ruisku, a syringe kuularuisku, XXX
maalaus, a painting ruiskumaalaus, spray painting
tarvike, a supply maalaustarvike, a painting supply
varasto, a storage tarvikevarasto, a supply storage
hylly, a shelf varastohylly, a storage shelf
metri, a meter hyllymetri, one meter of shelf, a unit of measurement
laku, licorice metrilaku, one meter long string of licorice
avain, a key lakuavain, a nickname for a small black magnetic access card
naulakko, a rack, a peg avainnaulakko, a key peg
vartio, a guard (as in "stand in guard") naulakkovartio, (the act of) guarding the rack (a military term)
päällikkö, a captain vartiopäällikkö, captain of the guard
taso, a level päällikkötaso, the executive level
geometria, geometry tasogeometria, plane geometry
virhe, an error geometriavirhe, a geometrical error (such as on tv screens)
vaihto, an exchange virhevaihto, an erroneous exchange
sähkö, electricity vaihtosähkö, alternating current
kazoo, a kazoo sähkökazoo, an electric kazoo
pilli, a whistle kazoopilli, a kazoo
housu, pants (actually it should be "housut") pillihousu, XXX
puku, a suit housupuku, trouser suit
pelle, a clown pukupelle, a suit (in a pejorative sense)
hyppy, a jump pellehyppy, stunt diving
lanka, string hyppylanka, a jump lead
kerä, a curl lankakerä, a ball of string
kaali, a cabbage keräkaali, a head cabbage
aivo, a brain kaaliaivo, "cabbage brain" (an insult)
vuoto, a leak aivovuoto, brain leak
suoja, a shiel vuotosuoja, a leak shield
vaate, a piece of clothing suojavaate, protective wear
kappale, a piece vaatekappale, a piece of clothing
myynti, sales kappalemyynti, unit sales
tykki, a cannon myyntitykki, a very good salesman
lava, a scaffold tykkilava, a gun carriage
tanssi, a dance lavatanssi, XXX
askel, a step tanssiaskel, a dance step
moottori, en engine askelmoottori, a step(ping) motor
pyörä, a wheel moottoripyörä, a motorcycle
koppi, a booth pyöräkoppi, bicycle booth
siemen, a seed koppisiemen, angiosperm
peruna, a potato siemenperuna, seed potato
palsta, a column (a writing in a newspaper) perunapalsta, a row of potatos
jako, division palstajako, XXX
viiva, a line jakoviiva, a division line (math.)
integraali, an integral viivaintegraali, a line integral
operaattori, an operator integraalioperaattori, an integral operator
algebra, algebra operaattorialgebra, operator algebra
oppi, a discipline (branch of knowledge) algebraoppi, algebra (as a discipline)
laitos, an institution oppilaitos, an educational establishment
kompleksi, a complex laitoskompleksi, institution complex
luku, a number kompleksiluku, a complex number
suora, a line lukusuora, the real line (math.)
veto, a stroke suoraveto, XXX
oikeus, justice, a right veto-oikeus, veto right
murha, a murder oikeusmurha, a juridical murder
ase, a gun, a weapon murha-ase, a murder weapon
varikko, a pit (in car races) asevarikko, a gun depot
pilttuu, a stall, a box varikkopilttuu, XXX